Group Protein

Format protein sequences with spacing and numbering for easy residue identification

Formatting Options

Residues per group10
Groups per line5
Show line numbers
Show position numbers

What is Group Protein?

Group Protein is a formatting tool that organizes protein sequences into readable blocks with spacing and numbering. It creates a convenient reference layout that makes it easy to quickly locate specific amino acid residues within protein sequences.

How to Use This Group Protein Tool

Quick guide to format your protein sequences:

  1. Paste your protein sequence(s) in FASTA or plain text format
  2. Adjust grouping options using the sliders and toggles
  3. View the formatted output with spacing and numbering
  4. Copy or download the formatted sequences

When to Use

This tool is useful when you need to:

  • Create readable protein sequence references for analysis
  • Quickly locate specific amino acid positions
  • Format sequences for presentations or publications
  • Compare multiple protein sequences side by side
  • Generate numbered protein sequence alignments

Example Input

Sample protein sequence:

MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLST

Supports both FASTA format and plain sequences.

Example Output

Formatted with 10 residues per group, 5 groups per line:

1 MVHLTPEEKS AVTALWGKVN VDEVGGEALG RLLVVYPWTQ RFFESFGDLS 50
51 T 51

Includes position numbers and customizable spacing.

FAQ

Q: Can I format multiple protein sequences at once?
A: Yes, enter multiple sequences in FASTA format with headers.

Q: What amino acids are supported?
A: All 20 standard amino acids plus ambiguous codes (B, Z, X, J, O, U).

Q: Can I adjust the formatting parameters?
A: Yes, use sliders to control group size and groups per line, plus toggles for numbering options.