Perform global pairwise alignment of protein sequences using Needleman-Wunsch algorithm with BLOSUM and PAM matrices
Pairwise protein alignment compares two amino acid sequences to identify regions of similarity using the Needleman-Wunsch global alignment algorithm. This method uses substitution matrices like BLOSUM62 to score amino acid matches and mismatches, accounting for evolutionary relationships and chemical properties of amino acids.
Quick guide to align protein sequences:
This tool is useful when you need to:
Sample sequences for alignment:
Seq 1: MKFLKFSLLTAVLLSVVFAFSSCGDDDDTGYLPPSQAIQDLLKRMKV
Seq 2: MKFLKGALLTAVLLSVVFAFSSCGDDDTGYLPPSQAIQDIIKRMKV Try with your own sequences or use the Example button.
Alignment showing matches (|), similarities (:), and gaps (-):
MKFLKFSLLTAVLLSVVFAFSSCGDDDDTGYLPPSQAIQDLLKRMKV
|||||.||||||||||||||||||||:|||||||||||:||.|||||
MKFLKGALLTAVLLSVVFAFSSCGDDDTGYLPPSQAIQDIIKRMKV Results include alignment score and identity percentage.
Q: Which scoring matrix should I use?
A: BLOSUM62 is recommended for most protein alignments. Use BLOSUM80 for closely related sequences or BLOSUM45 for distantly related sequences.
Q: What do the gap penalties mean?
A: Gap opening penalty is applied when starting a new gap, while gap extension penalty is for extending existing gaps. Typical values are -10 and -1.