Protein Molecular Weight

Calculate protein molecular weight with epitope tags and fusion proteins. Perfect for gel electrophoresis predictions.

Epitope Tags & Fusion Proteins

What is Protein Molecular Weight?

Protein molecular weight calculation helps predict gel migration patterns and plan purification strategies. This tool calculates precise molecular weights with support for epitope tags and fusion proteins.

How to Use This Calculator

Calculate protein molecular weights in 3 steps:

  1. Paste your protein sequence(s)
  2. Select any epitope tags to add
  3. View calculated molecular weights
  4. Compare with protein standards

When to Use

This tool is essential for:

  • Gel electrophoresis planning
  • Protein purification design
  • Expression construct planning
  • Mass spectrometry predictions

Example Input

Sample protein sequence (GFP):

MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSYQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK

Add His6 tag for 27 kDa total

Example Output

Detailed molecular weight analysis:

GFP: 26,901.4 Da + His6 tag: 840.9 Da Total: 27,742.3 Da

Perfect for SDS-PAGE planning

FAQ

Q: What epitope tags are supported?
A: His6, FLAG, Myc, HA, V5, and many others with customizable copy numbers.

Q: How accurate are the calculations?
A: Very accurate using standard amino acid molecular weights minus water for peptide bonds.