Random Protein Generator

Generate random protein sequences with customizable amino acid composition and properties for testing and statistical analysis.

What is Random Protein Generator?

The Random Protein Generator creates synthetic protein sequences with random amino acid composition. This tool is essential for evaluating the significance of sequence analysis results and for testing bioinformatics algorithms.

How to Use This Random Protein Generator

Generate random protein sequences in seconds:

  1. Set desired sequence length (1-10000 amino acids)
  2. Choose number of sequences to generate
  3. Click Generate or sequences appear automatically
  4. Copy or download FASTA-formatted output

When to Use

This tool is useful when you need to:

  • Create control sequences for statistical testing
  • Generate random sequences for algorithm validation
  • Test sequence analysis software with synthetic data
  • Evaluate significance of pattern matches

Example Input

Set parameters:

Length: 50 amino acids
Sequences: 5

Click Generate to create random sequences.

Example Output

Generated random protein sequences:

>Random_Protein_1
MKTLLIFLGLLVALSSLVQGSQWRSFEEPFNSTNRGYY
>Random_Protein_2
AFGIKLMNPQRSTVWYDEHIKACDEFGHILMPQSTUVWY

Each sequence is unique and random.

FAQ

Q: What amino acids are included?
A: All 20 standard amino acids with equal probability.

Q: Can I specify amino acid composition?
A: Currently uses uniform distribution for all amino acids.

Q: What's the maximum sequence length?
A: Up to 10,000 amino acids per sequence.