Generate random protein sequence samples from larger sequences. Sample amino acids with replacement from guide sequences for statistical analysis.
Sample Protein randomly selects amino acid residues from a guide protein sequence to construct new sequences. This tool performs sampling with replacement, maintaining the statistical properties of the original sequence while creating randomized variants.
Generate sampled protein sequences easily:
This tool is useful when you need to:
Sample guide protein sequence:
MKTLLIFLGLLVALSSLVQGSQWRSFEEPFNSTNRGYYSI
TYYRFKNAMKQGIHSYIKANSKFIGITELKKQKMEK The tool will randomly sample from these amino acids.
Sampled protein sequences:
>Sample_Protein_1 length=30
MKITLLGFQWRSFEEPNSTYRFKNAMQIH
>Sample_Protein_2 length=30
LLVALSSLVQGSQWRSFEPFNSTNRGYYS Each sample randomly selects from guide amino acids.
Q: What is sampling with replacement?
A: Each amino acid can be selected multiple times when building the new sequence.
Q: Does it preserve amino acid composition?
A: Statistically yes, though individual samples may vary from the guide.
Q: What's the maximum sample length?
A: Up to 10,000 amino acids per sampled sequence.