Sample Protein

Generate random protein sequence samples from larger sequences. Sample amino acids with replacement from guide sequences for statistical analysis.

What is Sample Protein?

Sample Protein randomly selects amino acid residues from a guide protein sequence to construct new sequences. This tool performs sampling with replacement, maintaining the statistical properties of the original sequence while creating randomized variants.

How to Use This Sample Protein Tool

Generate sampled protein sequences easily:

  1. Paste or upload your guide protein sequence
  2. Set desired sample length (1-10000 amino acids)
  3. Choose number of samples to generate
  4. Sampled sequences appear automatically

When to Use

This tool is useful when you need to:

  • Create control sequences for statistical testing
  • Generate randomized proteins with same composition
  • Bootstrap protein sequence data
  • Test protein analysis algorithms

Example Input

Sample guide protein sequence:

MKTLLIFLGLLVALSSLVQGSQWRSFEEPFNSTNRGYYSI
TYYRFKNAMKQGIHSYIKANSKFIGITELKKQKMEK

The tool will randomly sample from these amino acids.

Example Output

Sampled protein sequences:

>Sample_Protein_1 length=30
MKITLLGFQWRSFEEPNSTYRFKNAMQIH
>Sample_Protein_2 length=30
LLVALSSLVQGSQWRSFEPFNSTNRGYYS

Each sample randomly selects from guide amino acids.

FAQ

Q: What is sampling with replacement?
A: Each amino acid can be selected multiple times when building the new sequence.

Q: Does it preserve amino acid composition?
A: Statistically yes, though individual samples may vary from the guide.

Q: What's the maximum sample length?
A: Up to 10,000 amino acids per sampled sequence.